SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006203 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006203
Domain Number 1 Region: 1041-1085
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 5.69e-16
Family Nuclear receptor coactivator interlocking domain 0.00019
Further Details:      
 
Domain Number 2 Region: 125-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000655
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 
Domain Number 3 Region: 278-371
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000178
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.0025
Further Details:      
 
Domain Number 4 Region: 35-89
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000363
Family HLH, helix-loop-helix DNA-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006203   Gene: ENSMICG00000006798   Transcript: ENSMICT00000006808
Sequence length 1414
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1563:16319:55277:1 gene:ENSMICG00000006798 transcript:ENSMICT00000006808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGENSLDPLATDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXRALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKS
TVNGVSWTNETQRQKSHTFNCRMLMKTHDMLEDINTSPEIRQRYETMQCFALSQPRAMME
EGEDLSCMICARRITTGERAFXXXXXXXXXXXXXXXKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPLYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNPNPVGQGIRPPAAGCSNSVGGMSMSPNQGLQMLSNRAYGM
ADPSTTGQMSGTRYGGSSNIASLTPGPGMQSPSSYQNNSYGLSMSSPPHGSPGLGSNQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGTTGSHNFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNITQPSKVSSQDSKSPLGLYCDQNPVESSMCQSNSRDHLSDKESK
ESSVEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTSCGEG
NVKQEQLSPKKKENNALLRYLLDRDDPSDTLSKELQPQVEGVDNKMSQCSSSTIPSSSQE
KDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISTNGSHLGSKQQIFQGSNSLXXX
XXXXXXXXXXXXNRAVSLDSPVSVGSSPPVKNISAFPMVTKQPMLGGNPRMMDSQENYGS
NMGGPNRNVALHQTPSTEDWGLPNSKASRMEPMNSNSMGRPGGDYNVSLPRPAVGSSMPT
LPLRSNSIPGARPMLQQQQQLLQMRHGEIPMGMGINPYGQAAASNQPGSWPDGMLSMEGP
HGTQNRPILRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPEL
VNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLNQSRQALEMEMENPTTR
XXXXXXXXXXXXXXXXXXQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQ
QQQQQTTQAFSPPPNVTASPSMDGVLAGPAMPQAPPQQFPYPPSYGMGQPPDPAFGRVSS
PPNTMMSSRMGPSQNPMVQHPQAAPMYQPSDMKGWPSGNLARNSSFSQQQFAHQGNPAVY
SMVHMNGSSAHMGQMNMNSMPMSGMPMGPDQKYC
Download sequence
Identical sequences ENSMICP00000006203 ENSMICP00000006203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]