SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006249 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006249
Domain Number 1 Region: 455-560,682-779
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.37e-49
Family Phosphate binding protein-like 0.000000105
Further Details:      
 
Domain Number 2 Region: 72-392
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.28e-26
Family L-arabinose binding protein-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006249   Gene: ENSMICG00000006845   Transcript: ENSMICT00000006857
Sequence length 1449
Comment pep:known_by_projection scaffold:micMur1:scaffold_120:182775:497516:1 gene:ENSMICG00000006845 transcript:ENSMICT00000006857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPRAECCSPKFWLVLAVLAVSGSRARSQKSAPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKDDSSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIVTENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAP
PPLFCGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHL
FYWQFRHCFMGVCSGKPGMVFSISRGIYSCIVAIEERQSVMNSPTATMNNTHSNILRLLR
TAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYI
SEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSASSIDGLYDCDNPPFTTQPRPAGKKPL
DIGLPSSKHGQLSDLYGKFSFKSDRYGGHDDLIRSDVSDISTHTVTYGNIEGNAAKRRKQ
QYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTKENS
PHWEHVDLTDIXXXRGGRKHGAWGVLAPWELNEWEERAGNRSPSKLHNYPAAAPGPNSGR
QACIRCEACKKAGNLYDISEDNSLQELDQPAAPAAAASNASGAKYPQSPTNSKAQKKSRN
KLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFMDGSPYAHMFEMPAGESAFANSKPSV
PTAGHHHHNNPGGGGYMLSKSLYPDRVTQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGAS
KARPDFRALVTNKPVVSALHGAVPGRFQKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYE
KLSSIESDV
Download sequence
Identical sequences ENSMICP00000006249 ENSMICP00000006249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]