SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006308 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006308
Domain Number 1 Region: 1-385
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.3e-148
Family Phosphoglycerate kinase 0.00000000000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006308   Gene: ENSMICG00000006916   Transcript: ENSMICT00000006923
Sequence length 386
Comment pep:known_by_projection scaffold:micMur1:scaffold_8759:12883:27198:1 gene:ENSMICG00000006916 transcript:ENSMICT00000006923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVA
AELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKA
EPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSMVGVLQAVLLMTDYFASLESPERPFLAI
LGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMS
KAEKNGVKITLPVDFVTADKFDENAKTGQATVGSGIPQGWMGLDCGPESSKKYAEAVARA
KQIVWNGPVGVFEWEAFARGTKALMDDVVKATSRGCITIIGGGDTATCCAKWNTEDKVSH
VSTGGGASLELLEGKVLPGVDALSNI
Download sequence
Identical sequences ENSMICP00000006308 ENSMICP00000006308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]