SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006504 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006504
Domain Number 1 Region: 178-223
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-16
Family Fibronectin type II module 0.0026
Further Details:      
 
Domain Number 2 Region: 118-170
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000857
Family Fibronectin type II module 0.0054
Further Details:      
 
Domain Number 3 Region: 28-69
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000174
Family Fibronectin type II module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006504   Gene: ENSMICG00000007142   Transcript: ENSMICT00000007140
Sequence length 223
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3440:46615:58195:1 gene:ENSMICG00000007142 transcript:ENSMICT00000007140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGWSSYLLGWTTFLLYSYETQGSKTDECVFPFTYKGSVYFTCTKVGGLSPWCATRAVYD
GRWKHCMIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY
GGNSLSKPCIFPSSYRNSVVSECIEDDSNKLWCPTTEDMDKDGKWSLCADTRISSLAPGF
PCHFPFNYKNKNYYNCTNKGSKENLTWCATSYNFDQDHTWVYC
Download sequence
Identical sequences ENSMICP00000006504 ENSMICP00000006504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]