SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006594 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006594
Domain Number 1 Region: 168-344
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 9.03e-26
Family NadC C-terminal domain-like 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000006594
Domain Number - Region: 392-465
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.00357
Family NadC C-terminal domain-like 0.027
Further Details:      
 
Domain Number - Region: 38-54,94-133
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0177
Family NadC N-terminal domain-like 0.018
Further Details:      
 
Domain Number - Region: 67-99
Classification Level Classification E-value
Superfamily DUSP-like 0.0706
Family DUSP, domain in ubiquitin-specific proteases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006594   Gene: ENSMICG00000007240   Transcript: ENSMICT00000007241
Sequence length 473
Comment pep:novel genescaffold:micMur1:GeneScaffold_971:870:40715:-1 gene:ENSMICG00000007240 transcript:ENSMICT00000007241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEK
IQEAKEVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGSVIPRGNVLFTVENTDP
ECYWLTNWIETILVQTWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVS
SQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEK
DAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTEAPLIIRPDSGNPLD
TVLKVLDILGKKFPITENSKGYKLLPPYLRVIQGDGVDINTLQEXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNVFKDPVADPNKRSKKGRLSLHRTPTGN
FVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNAQLNIIELEAAPH
Download sequence
Identical sequences ENSMICP00000006594 ENSMICP00000006594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]