SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006732 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006732
Domain Number 1 Region: 285-495
Classification Level Classification E-value
Superfamily ALDH-like 8.51e-77
Family ALDH-like 0.00000000492
Further Details:      
 
Domain Number 2 Region: 12-211
Classification Level Classification E-value
Superfamily ALDH-like 6.54e-62
Family ALDH-like 0.0000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006732   Gene: ENSMICG00000007394   Transcript: ENSMICT00000007398
Sequence length 500
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3220:28549:182943:-1 gene:ENSMICG00000007394 transcript:ENSMICT00000007398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSGMPDLPVPLTNLKIQYTKIFINNEWHASVSGKKFAVINPATEEVICHVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLVLATMEAMNGGKVFSNAYL
MDLGGSIKALHYCAGWADKIQGRTIPADGKIFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GTALSCGNTVVVKPAEQTPLTALHVASLIKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSAVEYAHQGVCYHQG
QCCVAASRLFVEESIYDEFVRKSVERAKKYVFGNPLTPGVNQGPQVNKQQRDKILDLIES
GKKEGAKLECGGGWGNKGYFIQPTVFSNVTDDMRIAKEEIFGPVQQIMKFKTLDDVIKRA
NNTHYGLAAGIFTKDLDKAITVSSALQAGTVWVNCYSVVCAQCPFGGFKMSGNGRELGEY
GLHEYTEVKTVTVNISQKNS
Download sequence
Identical sequences ENSMICP00000006732 ENSMICP00000006732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]