SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006830 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006830
Domain Number 1 Region: 223-526
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-92
Family ALDH-like 0.000000000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006830   Gene: ENSMICG00000007499   Transcript: ENSMICT00000007504
Sequence length 545
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1061:52824:57623:-1 gene:ENSMICG00000007499 transcript:ENSMICT00000007504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSPWRRPRRPSRTRPTSTRSPWAWCSSSAPGTTPSTSPSSPRWAPSPQVLWAPVPGAGGS
PGAPSPWEGLGPVGRGPRSGDSWGLSREAAGTKLLSQASQCPTRQAQVSSPEDEEAYLSL
PACGSSCPRICARPSSPEAGAALPARPRELLSPFSSPSNISATPGTRRGSAGQHVPVCVC
MCSAAHVPASLPGTHRGGEAPGSVGRAEPSAGSGRRPDSECSAGNAVVLKPSELSENTAN
LLATIVPQYLDKDLFPVINGGVPETTEVLKERFDHILYTGSTGVGKIVMTAAAKHLTPVT
LELGGKSPCYVDKNCDLDVACRRVAWGKFMNSALSCVAPDYILCDPSXXXXXXXXXXXXX
XEFYGEDARKSRDYGRIINARHFQRVMALIEGQKVALGGTGDAASRYIAPTILTDVDPRA
PVMQEEIFGPVLPIVCVRGLEEAVQFINQREKPLALYVFSDSDQVIKKMIAETSSGGVTA
NDVIAHITVHTLPFGGVGHSGMGSYHGKKSFETFSHRRSCLVRSLLNEEVLKARYPPGQA
KATWR
Download sequence
Identical sequences ENSMICP00000006830 ENSMICP00000006830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]