SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006888 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006888
Domain Number 1 Region: 103-339
Classification Level Classification E-value
Superfamily vWA-like 5.78e-51
Family Integrin A (or I) domain 0.00000874
Further Details:      
 
Domain Number 2 Region: 1499-1700
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-34
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 3 Region: 1135-1286
Classification Level Classification E-value
Superfamily Fibronectin type III 2.59e-28
Family Fibronectin type III 0.00000445
Further Details:      
 
Domain Number 4 Region: 962-1080
Classification Level Classification E-value
Superfamily CalX-like 1.96e-20
Family CalX-beta domain 0.00059
Further Details:      
 
Domain Number 5 Region: 1-50
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000105
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 509-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number 7 Region: 596-637
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000484
Family Integrin beta tail domain 0.011
Further Details:      
 
Domain Number 8 Region: 551-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family Integrin beta EGF-like domains 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000006888
Domain Number - Region: 479-510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0053
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 438-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006888   Gene: ENSMICG00000007555   Transcript: ENSMICT00000007571
Sequence length 1795
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1603:409630:455512:1 gene:ENSMICG00000007555 transcript:ENSMICT00000007571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRCKKAQVKSCTECVRVGKDCAYCTDETFKERRCNTQAELLAAGCRHESVVVMESSFQIL
EESQIDINLQRSQVSPQSLRVRLRPGEEQHFELEVFEPKESPDLYILMDXXXXXXXXXXX
XXXXXXXXXRVLSDLTRDYTIGFGKFVDKVTVPQTDMRPEKLKEPWPNSDPPFSFKNVIS
LTEDVEEFRNKLQGERISGNLDAPEGGFDAILQTAVCTXXXXXXPDSTHLLVFSTESAFH
YEADGANVLAGIMSRNDERCHLDATGSYTYRTQDYPSVPTLVRVLGKHNIIPIFAVTNYS
YSYYEKLHTYFPVSSLGVLQEDSSNIVELLEAAFERIRSNLDIRALDSPRGLRTEVTSNM
FEKTKTGSFHIQRGKVGTYQVHLRAIEDVDGTHVCQLPVEDQKGNIHLKPSFSDGLRMDV
GIVCDTCACELQKEVQSARCNFRGDFACGHCVCSEGWSGKTCNCSTGLLSDMQPCLRADE
DKPCSGRGECQCGHCVCYGEGRYEGQFCEYDNYQCPRTSGFLCNDRGRCSMGQCVCEPGW
TGPSCDCPLSNATCIDSNGGICNGRGHCECGRCHCNQQSLYTDTTCEINYSAVRLGLCED
LRSCVQCQAWGTGEKKGRTCEECSFKVKMVDELKKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXCPPSSFWWLIPLLLFLLLLLPLLLLLCWKYCACCKACLALLPC
CNRGHMVGFKEDHYMLRENLMSSDHLDTPMLRSGNLKGRDTVRWKITNNMQRPGFATHAA
STNPTELVPYGLSLRLARLCTENLLKPSTRECDQLRREVEENLNEVYRQIAGAHKLQHTK
FRQQPNAGKKQDHTIVDTVLMAPRSARQALLKLTEKQVEQGSFHELKVAPGYYTLTADQD
ARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPVGTATLGRRLVNITVIKEQA
SGVVFFEQPEYTVSRAEQVARIPVVRRILDNGKSQVSYRTQDNTAQGNRDYVPTEGELLF
HPGETWKELQVKLLELQEVDSLLRGRQTRRFHVQLSNPKFGARLGQPHSATVIIGDRDRX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKYWIQGD
SESEAHLLDSKVPSVELTNLYPHCDYEMKVCAYGAQGEGPYSSLVSCRTHQEVPSEPGRL
AFNVVSSTVTQVSWAEPAETNGEITAYEVCYGLVNEDNRPIGPMKKVLVDNPKNRMLLIE
NLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSIPIIPDIPIVDAQGGEDYESF
LMYSDDVLRSPSGSQRPSVSDDTGGGWKFEPLLGEELDLRRVTWRLPPELIPRLSASSGR
SSDAAEAPRGPPDDGDAGGEGGSLPRSVTPGPAGEHLVNGRMDFAFPGSANSLHRMTVAN
TAYGTHLSPQLPHRVLSTSSTLTRDYHSLSRTEHSHSTLPRDYSTLTSLSSHDSRLTSGV
PDTPTRLVFSALGPTSLKVSWQEPQCERALQGYSVEYQLLSGGELYQLNIPNPGQTSVVV
EDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSTFTLSTPSAPGPL
VFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGGPATTFRVDGDNPESRLTVPGLS
ENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSHPGLFQHPLQGEYSSVTTTH
SSSTEPFLVDGLTLGSQRLEAGGSLTRHVTQEFVSRTLTTSGTLSTQMDQQFFQT
Download sequence
Identical sequences ENSMICP00000006888 ENSMICP00000006888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]