SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006898 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006898
Domain Number 1 Region: 362-462
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.51e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00099
Further Details:      
 
Domain Number 2 Region: 103-168
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000051
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 183-237,265-279
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000013
Family N-terminal PAS domain of Pas kinase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006898   Gene: ENSMICG00000007583   Transcript: ENSMICT00000007584
Sequence length 628
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4750:122534:194479:1 gene:ENSMICG00000007583 transcript:ENSMICT00000007584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAHSQTEKRRRDKMNNLIE
ELSAMIPQCKPVARKLDKLSVLRMAVEHLKSLKGMTNSYVGDNYRPSFIQDNELRHLILK
TAEGFLFVVGCERGRILFVSKSVSKTLNYDQASLTGQSLFDFLHPKDVAKVKEQLSSSDI
SPREKLVDAKTGLQVHSNFHSGRMHMYSGSRRSFFCRIKSCKISVKEEHEGLPNSKKKEH
RKFYTIHCTGYLRSWPPNIVGMEEERDNRKENNNFTCLVAIGRLHPYIVPQNSGEIKVKP
TEFITRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSNLTDKHKAVLQSKE
KIFIDSYKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLRHSETLETSFFPCSS
HSSEESSKQPCTSVPGISSGTVLGAGSIGTDIANEVLDLQRLQSSSSLDDSSPTDLMKET
HTVNCRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNAQLDFDALCDNDDT
AMAAFMNYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences ENSMICP00000006898 ENSMICP00000006898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]