SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006911 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006911
Domain Number 1 Region: 34-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.7e-50
Family Ribosomal protein S7 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006911   Gene: ENSMICG00000007599   Transcript: ENSMICT00000007597
Sequence length 242
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1652:114192:116732:1 gene:ENSMICG00000007599 transcript:ENSMICT00000007597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAVKGVRGWSSLPLVARRAVLRLPGVTQVRWSRYGPEYRDPKIDKEYYHKPVAELTE
EEKYDQELKKTQLIKAAPAMKTSSVFEDPVISKFTNMMMKGGNKVLARSLMTQTLEAVKR
KQFEKYHAASAEEQATIERNPYTIFHQALKNCEPVIGLVPILKGGHFYQVPVPLADRRRR
FLAMKWMITECRENKHRRTLMPEKLSHELLEAFHNQGPVVKKKQDMHKMAEANRALAHYR
WW
Download sequence
Identical sequences ENSMICP00000006911 XP_012634240.1.48125 ENSMICP00000006911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]