SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006926 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006926
Domain Number 1 Region: 117-266
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.84e-43
Family Mannose 6-phosphate receptor domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 270-414
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-40
Family Mannose 6-phosphate receptor domain 0.000000387
Further Details:      
 
Domain Number 3 Region: 574-709
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.22e-40
Family Mannose 6-phosphate receptor domain 0.00029
Further Details:      
 
Domain Number 4 Region: 1314-1455
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.15e-36
Family Mannose 6-phosphate receptor domain 0.00051
Further Details:      
 
Domain Number 5 Region: 424-565
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-32
Family Mannose 6-phosphate receptor domain 0.0015
Further Details:      
 
Domain Number 6 Region: 1464-1591
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-32
Family Mannose 6-phosphate receptor domain 0.000000256
Further Details:      
 
Domain Number 7 Region: 1171-1311
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.49e-32
Family Mannose 6-phosphate receptor domain 0.00019
Further Details:      
 
Domain Number 8 Region: 1-114
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-30
Family Mannose 6-phosphate receptor domain 0.00000144
Further Details:      
 
Domain Number 9 Region: 1596-1741
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.46e-30
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 10 Region: 1040-1167
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.35e-28
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 11 Region: 2052-2199
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.27e-26
Family Mannose 6-phosphate receptor domain 0.0021
Further Details:      
 
Domain Number 12 Region: 1931-2045
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 9.29e-22
Family Mannose 6-phosphate receptor domain 0.0025
Further Details:      
 
Domain Number 13 Region: 1748-1841,1890-1933
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.45e-21
Family Mannose 6-phosphate receptor domain 0.0042
Further Details:      
 
Domain Number 14 Region: 1840-1889
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-17
Family Fibronectin type II module 0.00089
Further Details:      
 
Domain Number 15 Region: 707-785
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00000000000000113
Family Mannose 6-phosphate receptor domain 0.0054
Further Details:      
 
Domain Number 16 Region: 856-975
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00000000000000744
Family Mannose 6-phosphate receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006926   Gene: ENSMICG00000007582   Transcript: ENSMICT00000007613
Sequence length 2410
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1740:80822:168339:1 gene:ENSMICG00000007582 transcript:ENSMICT00000007613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YTWEAVDTANNILYKINVCGDVNIAQCGSSSAVCMHDLKTDSYRSVGSSALRSMATSILE
FNTTVDCEKQGHKIQSSITFLCGKSLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEV
PCYAFDEELRKHDLNPLIKLSGGYLVDDSDPDTSLYINVCRDIDSLRDPGSQLRACPAGT
AACLVRGDEAFDVGQPKEGLKLVGKDRLVLSYVKEEAEKLDFCDGHSPAVTITFVCPSER
REGTIPKLTAKSNCRYEIEWVTEYACHRDYLESKTCSLSSGQQDVAVDLRPLAQGKGLFY
HSDGKEYTFYLNVCGGTETQICNKKDTAVCQIKKTDSTQVKVAGRYQTQTLRYSDGDLTL
LYFGGDECSSGFQRMSVINFECNKSADDDGRGSPVFTGEVDCTYFFTWDTKYACVKEKED
LLCGATDGQKRYDLSALARHSEPEQNWEAVDGSQAETEKKHFFINICHRVLRGGKAQGCP
EDAAVCAVDKSGSKNLGKFISSPTTEKGNIQLSYSDGDDCGDGKKIRTNITLVCKPGDLE
SAPVFRTSGDNGCFYEFEWHTAAACVLSKTEGENCTVFDSQAGFSFDLSPLMKKSGAYKV
ETRKYDFYINVCGPVSAGSCQPGSGACQVARSDKKTWNLGQSNAKLSYYDGMIQLNYRDG
TPYNNERHTPRSTLITFLCDRDAGVGSPEYQEEDNSTYNFRWYTSYACPEEPLECVVTDP
STLEQYDLSRLAKSEGGRGGNWYAMDTSGEHVTWRKYYINVCRPLNPVPGCDRYASACQM
KYEKDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXNSHPIFSLNWECVVSFLWNTEAACPVQTTTDTEQACSIRDPNTGFVFNLNPLNS
SQGYVVSGIGKTFVFNVCGTMPVCGTVDGKPASGCESNTQTDSLEDLRPERPVGLEKSLQ
LSTEGFITLTYKGPLSATRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXSAGNEYDLSGLSSVRKPWTAVDTSADGQRRTFYLSVCDPLPYI
PGCHGSAVGSCLVTETNSWNLGVVQISPQVAANGSLTIVYVNGDKCGAQRFSTRITFECA
QISGSPTFQLLDNCEYVFVWRTVEACPVVRVEGDNCEVRDPRHGNLYDLKPLALNDTIVR
AGEYNYYFRVCGQLSSGVCLTSDRSKVVSSCQEKPGLQGFQRVAGLLTQKLTYENGLLKI
NYTGGDTCHKVYQRSTTIFFYCDRSTQKPVFLKETSDCSYLFEWRTQYACPPFDVTECSF
EDAAGNSFDLSSLSRYSDNWEAVTGTGSTEHYLINVCKSLSPQAGTEPCPPEAAACLLGG
SKPVNLGRVRDGPQRSDGVIVLKYVDGDSCPDQIRKKSTTIRFTCSESQVNSRPMFISAV
EDCEYTFSWPTAAACAVKSNVHDDCQVTNHLFDLSSLSGRAGFTAAYSEKGLVYMSICGE
NENCPPGVGACFGQTRISVGKASKRLTYADQVLRLVYENGSPCPSKSSLSYKSVISFVCR
PDSGPANRPMLISLDKQTCTLFFSWHTPLACEQAIECSVRNGSSIIDLSPLIHRTGGYEA
YDESEDEASDASPDFYINICQPLNPMHGVPCPAGAAVCKVPVDGPPIDIGRVAGPPILNP
VAKEIYLNFESSTPCLADRHFNYTSLIAFHCKRGVSMGTPKLLRTSDCDFVFEWETPIVC
PDEVRTEGCALTDEQLLYSFNLSSLSKSTFKVTRDLRTYSVGVCTAATGPDQGGCKDGGV
CLLSGSKGVSFGRLASMKLDYRHQDEAVILSYVNGDACPPETDEGVPCVFPFTFNGKSYE
ECVVEGRAKLWCSTTANYDRDREWGFCRHSKSHRTSTIIFKCDEDEDVGRPQVFSEVRGC
EVTFEWKTKVVCPPTKMECKFVQKHKTYDLRLLSSLTGSWSLVHEGAGRATGEVQVLGLI
HTQKLDAKDDKVIVTYSKGYPCGDNKTASTVIELTCAKTVGRPAFERFDIDSCTYYFSWD
SRAACAVKPQEVRMVNGTITNPINGKSFSLGDIYFKLFRASGDMRTNGDNYLYEIQLSTI
TSSRNPACSGANICQVKPNDQHFSRKVGTADKTKYYVQDGDLDVVFASSSKCGKDKTKSV
SSTIFFHCDPLVKDGIPEFSHDTNGRQYLFSWYTSAVCPLGDTEDPGDSGPGSKGLSERS
QAVGAVLSLLLVALTGCLLGLLLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNKEEEAD
ENETEWLMEEIQLPTPRPGKEGQENGHITTKSVKAEALSSLRGDDQDSEDEVLTIPEVKV
HSGRAGGAESSHPARNPRRKAPGEPADDRVGLVPGERARRGRPRSAQQKAAAPTTLVSFH
DDSDEDLLHI
Download sequence
Identical sequences ENSMICP00000006926 ENSMICP00000006926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]