SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007112 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007112
Domain Number 1 Region: 317-418
Classification Level Classification E-value
Superfamily POZ domain 2.59e-17
Family Tetramerization domain of potassium channels 0.0093
Further Details:      
 
Domain Number 2 Region: 81-148
Classification Level Classification E-value
Superfamily POZ domain 0.000000262
Family Tetramerization domain of potassium channels 0.046
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000007112
Domain Number - Region: 206-268
Classification Level Classification E-value
Superfamily POZ domain 0.0523
Family Tetramerization domain of potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007112   Gene: ENSMICG00000007810   Transcript: ENSMICT00000007814
Sequence length 846
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_322:252203:265870:-1 gene:ENSMICG00000007810 transcript:ENSMICT00000007814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLDNLKEGKHHLRGRPADIPVAEEASLNRTKGSDKPSEFPMESGRWTGLHDKAPLGLMDT
PLLDTEEEVHYCFLPLDLVARYPSLVTEDNLLWLAETVALVECECSEFRFIVNFLRSQKI
LLPDNFSNIDVLEAEVEILEIPELTEAVRLYRMNMGRSPGKPGLGAQSSLEQEEPSQGGC
SRTSCPPLSPGKGSRTASLESVKPLYMMALGLLVKYPDSALGQLHIESTLDGSRLYITGN
GVLFQHVKNWLGTCRLPLTETISEVYELCAFLDKRDITYEPMKVALKTHLEPRMLAPMDV
LTDEEWTAEITVYSPQQIIKVYVGSHWYATTLQTLLKYPELLSNPQRAYWITYGQTLLIH
GDGQMFRHVLNFLRLGKLFLPSEFKEWPLFCQEVEEYHIPTLSEALAQCEAYKSWTQEKE
SENEEAFPIRRLHVVTEGPGSLMEYSRDAKETTAYMPVDFQDCNDRTPWNKAKGHLARSS
QMEEAEQYTRSIQVSLCRNTKRAGNPSTYSHCPGLCTNPRHWRGHPESPPKKKCTTVNLT
QKSETKEPPVTPMQKLISLVREWDMANCKQWGFQSPTAPRGNPLEEATLQLPLGSEAASQ
PSTSAAWKAHSTAPEKDPGPQAGPGAGAKDKGPEPNFKPYFPMKRAVTLKDWNKQKPKER
ESPAPEQPLPEASEVDSPGVILKVTHPPVVGSDGSCMFFEDSIIYTTHMEHLGLTPPKTS
PQAREVTFLSFSLSWEEMFYAQKCHRFLTDIILDSIRQKDPKAITAKVVSLANRLWTLHI
SPKQFVVDLLAISGFKDDRHTQERLYSWVELTLPFARKYGRCVDLLIQRGLSRSVSYSIL
SKYLQE
Download sequence
Identical sequences ENSMICP00000007112 ENSMICP00000007112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]