SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007164 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007164
Domain Number 1 Region: 557-842
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-55
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 77-294
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.5e-16
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007164   Gene: ENSMICG00000007841   Transcript: ENSMICT00000007868
Sequence length 963
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1512:860633:876241:-1 gene:ENSMICG00000007841 transcript:ENSMICT00000007868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGGWGPDSRLSWRARPGAEPPGGAGAARSGGTEGPAQRCGCPGAMASAARWSGLLLQLAA
LLGTLGPQVQTLRPESLLLVSTLDGSLHALSKHTGDLKWTLKDDPIIQGPMYVTEMAFLS
DPADGSLYILGTQKQQGLMKLPFTIPELVHASPCRSSDGVFYTGRKQDAWFVVDPESGET
QMTLTTEGPSTPRLYIGRTQYTVTMHDPRAPGLRWNTTFRRYSAAPMDGSPGKYVSHLAS
CGMGLLLTVDPASGTVLWTQDLGMPVVGVYTWHQDGLRQLPHLTLARDTLHFLALRWGHI
RLPASGPQNTATVFSALDTQLLMTLYVGKEEAGFYVSRALVHTGVALVPRGLTLAPTDGP
TTEEVTLQVSGEREGSPSTAVRYPSGSVALPSQWLLIGHHELPPVLHTTMLRVHPTPASG
AAETRPPESTQASAVFLELLSLSREKPWDLELHPEEKTPDSSPWLGSHDLLAAGLTAVLL
GGWILFLLGQPQQQLVEKQQHTPLPPADPPHISQDTRSQHSEATVRGQKRLQSRSEQAQS
LDDPEAEPLTVVGKISFNPKDVLGRGAGGTFVFRGQFEGRAVAVKRLLRECFGLVRREVQ
LLQESDRHPNVLRYFCTEQGPQFHYIALELCRASLREYVENPDLDLGGLEPELVLQQLTS
GLAHLHALHIVHRDLKPGNILIAGPDSRGQGRVVLSDFGLCKKLPAGRHSFSLRSGIPGT
EGWMAPELLQLLPPDSPTSAVDIFSAGCVFYYVLSSGSHPFGESLYRQANILAGAPCLAH
LEEEAHDKVLAQDLVEAMLSPLPQARPSAQQVLAHPFFWSRAKQLQFFQDVSDWLEKESE
QGPLVRALEAGGYKVVRNNWHKHISLPLQTDLRRFRSYKGTSVRDLLRAMRNKKHHYREL
PADVRQTLGRVPDGFVQYFTDRFPRLLLHTHHAMRSCASESLFLPYYSPASEARESCSGA
AGS
Download sequence
Identical sequences ENSMICP00000007164 ENSMICP00000007164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]