SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007204 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007204
Domain Number 1 Region: 710-963
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.83e-63
Family alpha-mannosidase, C-terminal domain 0.00049
Further Details:      
 
Domain Number 2 Region: 111-289
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.15e-44
Family alpha-mannosidase 0.00092
Further Details:      
 
Domain Number 3 Region: 310-408
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.11e-26
Family alpha-mannosidase, domain 2 0.0015
Further Details:      
 
Domain Number 4 Region: 388-474
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000816
Family alpha-mannosidase, C-terminal domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000007204
Domain Number - Region: 1-46
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000104
Family alpha-mannosidase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007204   Gene: ENSMICG00000007904   Transcript: ENSMICT00000007909
Sequence length 966
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_99:4290:39773:1 gene:ENSMICG00000007904 transcript:ENSMICT00000007909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESMRAYAANVYTSVVEELSRGQQRRFIAVEQEFFRLWWDGVASDQQKHQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATTPTLFALA
GFNAHLISRIDYNLKEVRQAAQELQFVWQGSPSLSAQQQIFTHIMXXXXXXXXXXXXXXX
XSGFYWNGVAVFPEPPADGVYPNMSEPVTPANIGLYAEALVANVKQRAAWFRTPHVLWPW
GCDKQFFNASVQFANMDRLLDHVNSHAASLGVSVQYATLGDYFRALHALNVXXXXXXXXX
XXXXXXXPFQAWTGFYTSRSALKGLARRASALLYAGESMFARYMWPAPLGPLDPAWALQQ
LRQLRWAVSEVQHHDAVTGTESPKVRDMYEEHLASGMLGVRKLMASIVLDGPQPGAGRAA
PAADPGAGPAGHFVTAYNPLAWTVTTIITLTVAFPGVSVTDELGHSVPAQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYYPMVQSAF
VEDGRSRLVLLSERAHGVSSQGNGQVEVMLHRRLWNNLDWDLGYNLTLNDTSVVHPVLWL
LLGPWSATTALRQRSGLALQHRPVVLFGELAGTTLNHPGPQKHEAVTLPPNVHLQILSIP
GWNYSSNHTEHVQNLQKGHGGEAQADLHRVLLRLHHLYEAGEDPVLSQPVTVDLEAVLRG
LGPIAAVEERSLTGTWDVSTLRRWSWGTETGHCRGRSTFPSRSSQGPTITIHPKEIRTFF
IHFRQQ
Download sequence
Identical sequences ENSMICP00000007204 ENSMICP00000007204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]