SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007356 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007356
Domain Number 1 Region: 165-422
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.35e-80
Family Eukaryotic proteases 0.00000000282
Further Details:      
 
Domain Number 2 Region: 52-160
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-32
Family Kringle modules 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007356   Gene: ENSMICG00000008071   Transcript: ENSMICT00000008073
Sequence length 430
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3817:178823:183385:1 gene:ENSMICG00000008071 transcript:ENSMICT00000008073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKILPPCLLLCALVVKAFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNCPKFQGEH
CEIDTAKTCYHGNGHSYRGKANTDIRGRPCLAWNSNPVFLQTYHAHRPDALQLGLGKHNY
CRNPDNQRRPWCYVQVGLKQIVQECKVPDCSVGTRPFSPPEQSEFQCGQKALRPRFKIVG
GEFTSIENQPWFAAIYRRHRGGSVSYFCGGSLISPCWVLSATHCFINSPRKEDYIVYLGR
SRLNSNTHGEMKFEVEELILHEDYSADTLAHHNDIALLKIRTSEGQCAQPSRSIQTICLP
PMYGDARFGTSCEITGFGKENHTDYLYPEQLKMTVVKLISHQQCQQPHYYGSEVTSKMLC
AADPQWETDSCQGDSGGPLICSTQGRLTLTGIVSWGRGCALKDKPGVYTRVSRFLPWIRA
HTGEENGLAP
Download sequence
Identical sequences ENSMICP00000007356 ENSMICP00000007356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]