SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007476 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000007476
Domain Number - Region: 3-60
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000915
Family VPS37 C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007476   Gene: ENSMICG00000008208   Transcript: ENSMICT00000008204
Sequence length 145
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3760:56480:57900:1 gene:ENSMICG00000008208 transcript:ENSMICT00000008204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THRWSPHCALGWLQAELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAE
KLQELLRRRERSAQPAPTAAADPPKPFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPPLK
GSPGCPLGPAPLLSPRPSQPEPPHR
Download sequence
Identical sequences ENSMICP00000007476 ENSMICP00000007476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]