SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007540 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007540
Domain Number 1 Region: 210-347
Classification Level Classification E-value
Superfamily C-type lectin-like 6.75e-33
Family C-type lectin domain 0.00089
Further Details:      
 
Domain Number 2 Region: 349-479
Classification Level Classification E-value
Superfamily C-type lectin-like 4.56e-29
Family C-type lectin domain 0.00071
Further Details:      
 
Domain Number 3 Region: 1105-1224
Classification Level Classification E-value
Superfamily C-type lectin-like 8.27e-28
Family C-type lectin domain 0.00073
Further Details:      
 
Domain Number 4 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.11e-24
Family Cysteine rich domain 0.013
Further Details:      
 
Domain Number 5 Region: 505-625
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-18
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 6 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000166
Family Fibronectin type II module 0.0023
Further Details:      
 
Domain Number 7 Region: 1397-1464,1609-1663
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000509
Family C-type lectin domain 0.019
Further Details:      
 
Domain Number 8 Region: 799-912
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000169
Family C-type lectin domain 0.022
Further Details:      
 
Domain Number 9 Region: 1238-1320
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000997
Family C-type lectin domain 0.013
Further Details:      
 
Domain Number 10 Region: 709-806
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000332
Family C-type lectin domain 0.0026
Further Details:      
 
Domain Number 11 Region: 949-989
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000108
Family C-type lectin domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007540   Gene: ENSMICG00000008258   Transcript: ENSMICT00000008277
Sequence length 1722
Comment pep:novel genescaffold:micMur1:GeneScaffold_2026:69414:174449:-1 gene:ENSMICG00000008258 transcript:ENSMICT00000008277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRWATPRGAAGLLLLLLRCLGLAEPSGRSGNDPFTIVNGNTGNCIKPLAGWIVATYCD
GTEGMLWKWVSQHRLFHLQTQKCLGLDITQPSDVLRMFSCDANVMLWWKCDRHSVYGAAQ
YRLALKGVHAIATTNASDVWKKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLVDGTWH
HECVLDENHNGPWCATTLNYEYDQKWGICLKPENGCKDNWEKNEQIGSCYQFNTQAALSW
KEAYVSCQNQGADLLSINNAAELTYLKEKEGIARIFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDRPSASIIGGSSCARMDAESGWWQSFSCEAQLPYVCRKPLNDTVESTDVWTYSDTR
CDAGWLPSNGFCYLLVNKSDSWDEAHMKCKAFGSDLISIHSLADMEVVVTKLHNGDAKEE
IWIGLKNINVPTLFQWSDGTEVTLTYWDENEPNVPYNQTPNCVSYLGKLGQWKVQSCXXX
XXXXXXXXXXXXXXXXXXXXXXXXXGWERHGETCYKIYKDEVPFGTNCNLTINSRFEQEY
LNDMMKKYDKSLTKYFWTGLRDIDSRGEYSWSTVGGIKQAVTFSNWKFLEPASPGGCVAM
STGKSLGKWEVKDCKSFRALSICKKISGPLKPEEAAPKPNDPCPEGWHSFPSGLSCYKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQRWLWIGLNKRSP
DLQGSWQWSDHTPVSTIIMADEFQQDYDIRDCAAVKVIRRPWHRGWHIYEDREIIYFRPF
ACDTKLEWVCQIPKGRTPKTPDWYNPERAGIHGPPVVIEGSEYWFVADPHLNYQEAVLYC
ASNHSFLATITSFAGLKAIRNKIANISVDEQKWWVRAHGPPIEHNFIYSRPLWRHFHLTF
GEECLYTSAKTWLMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAKVQCSRNWIPFQN
KCFLKIKPRSLTFSQASEVCHSYGGTLPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFEEESYYHCALILNLQKSPFTGTWNFTSC
SERHFVSLCQKYSEIKGGETLQNTSDTVKYLNNLYKIIPKSLTWHAAQKECLKNNMHLVS
ITDPYHQAFLTVQAVLHNASLWIGLSSQDDELNFGWSDGKRLHFSRWAEDNEQLEDCVVL
DTDGFWKTADCNDDQPGAICYYPGNETEKEVKPVDSIKCPSSVLNTPWIPFQNCCYNFMI
TKNTHVATTQDEVHSECQKLNPKSHILSIRNENENNFVLEQLLYFNYMASWVMLGITYEX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXDYKEEYNTTLPQFIPYEDGVYNIIQKKVTWYEALSTCSQSGGYLASVHNQNGQLF
LEDIVKRDGFPLWVGLSSHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSWSWLDGSEVK
FFKWENKSKSGNGKCSILLASNETWKKVECAHGFGRVVCKVPLGPDYRGIAITIAILSVL
ALISVLIWFFFQKNRLHWARFSSVRYEQGVNEDEIMLPSFHD
Download sequence
Identical sequences ENSMICP00000007540 ENSMICP00000007540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]