SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007705 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007705
Domain Number 1 Region: 121-208
Classification Level Classification E-value
Superfamily Kringle-like 2.25e-34
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 2 Region: 210-294
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-33
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 3 Region: 301-347
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000116
Family Kringle modules 0.001
Further Details:      
 
Domain Number 4 Region: 669-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000000255
Family Eukaryotic proteases 0.00026
Further Details:      
 
Domain Number 5 Region: 432-469
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000362
Family Kringle modules 0.0033
Further Details:      
 
Domain Number 6 Region: 36-84
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000942
Family Hairpin loop containing domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007705   Gene: ENSMICG00000008463   Transcript: ENSMICT00000008463
Sequence length 728
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_122:121342:194657:-1 gene:ENSMICG00000008463 transcript:ENSMICT00000008463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPVLLLQHVLLHLLLLPIAIPYAEGQRKRRNTLHEFKKSAKTTLIKEDPFLKIK
TKKMNTADQCANRCIRNKGLPFTCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTETGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSPVNDTDVPT
ETTECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRXXXXXXXXXXXX
XXPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXGDYGGPLVCEQHKMRLVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVQQS
Download sequence
Identical sequences ENSMICP00000007705 ENSMICP00000007705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]