SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007709 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007709
Domain Number 1 Region: 11-260
Classification Level Classification E-value
Superfamily ALDH-like 5.37e-63
Family ALDH-like 0.0000218
Further Details:      
 
Domain Number 2 Region: 385-492
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-27
Family ALDH-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007709   Gene: ENSMICG00000008467   Transcript: ENSMICT00000008467
Sequence length 510
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1428:62085:72234:-1 gene:ENSMICG00000008467 transcript:ENSMICT00000008467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVVVAVAVQTRILQPTAELLEGKFGESKSDKWIDSHNPATNEVIRHSPQATKAEMDAA
VASCKRAFPTWADTSVLSHQQVMLRYQQLIKENLKEIVKLITLEGKTLADAEGDIFGDFQ
VVEHAYSVTSLMLGETMPSITKDMDLYSYRLPLGVCAGIAPFNFPAMIPLWMFPMAMVCG
NTFIMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPNIKAISFVGSN
QAGEYIFERGSRNGKRVQANMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXPNMTCYKEEIFGPVLVVLETETLDEAIKIVNDNPY
GNGTAIFTTSGATARKYSHLVDVGQVGVNVPIPVPLPMFSFTGSRSSFGDNFYGKQGIHF
YTQLKTITSQWKEDDATLSSPAVAMPTMGR
Download sequence
Identical sequences ENSMICP00000007709 ENSMICP00000007709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]