SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008018 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008018
Domain Number 1 Region: 31-512
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-184
Family ALDH-like 0.000000000000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008018   Gene: ENSMICG00000008819   Transcript: ENSMICT00000008808
Sequence length 517
Comment pep:known_by_projection scaffold:micMur1:scaffold_634:404149:405702:1 gene:ENSMICG00000008819 transcript:ENSMICT00000008808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRCLVPRLLCLHGRTAPYSSAAALPSPIPNPDIRYNQLFINNEWRDAVSKKTFPTVNPA
TGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLA
SLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCG
QIIPWNFPLAMQSWKLAPALATGNTVVMKVAEQTPLSALHVASLVKEAGFPPGVVNIITG
YGPTAGAAIAKHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
GHAVEQCHEALFFNMGQCCCAGSRTFVEESIYDEFLERTVEKAKQRKVGNPFRLDTQQGP
QVDKEQFEKILGYIKLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVIERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Download sequence
Identical sequences ENSMICP00000008018 ENSMICP00000008018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]