SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008105 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008105
Domain Number 1 Region: 38-121,577-620,674-824
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.53e-24
Family WD40-repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 27-99,177-294,348-397,492-513,567-623
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000165
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008105   Gene: ENSMICG00000008892   Transcript: ENSMICT00000008900
Sequence length 1224
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4591:561996:632162:1 gene:ENSMICG00000008892 transcript:ENSMICT00000008900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPYTVNFKVSARTLTGALNAHNKAAVDWGWQGLIAYGCHSLVVVIDSNTAQTLQVLEKH
KADVVKVKWARENYHHNIGSPYCLRLASADVNGKIIVWDVAAGVAQCEIQEHAKPIQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTSE
GIVFISDFSPSKPPSGPGKKVYISSPHSSPAHNKLAAATGAKKALNKVKILITQEKPSAE
FITLNDCLQLAYLPSKRNHMLLLYPREILILDLEVNQTVGVIAIERTGVPFLQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDPVQELTYDLRSQCDAIRVTKTVRPFS
MVCCPVNENSAALIVSDGRVMIWELKSALCNRSSRNSSSGVSPLYSPVSFCGIPVGVLQN
KLPDLSLDNMIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXTGNGSVLVYHLTSGLLHKELSIHSCEVXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXRSIAFRGERGNDESPIEMIKVSHLKQYLAVVFKDKPLELWDVRTC
TLLREMSKNFPAITALEWSPSHNLKSLRKKQLATREAMARQTVVSDTELSIVESSVIXXX
XXXXXXXXLSQNISAREHFVFTDNDGQVYHLTVEGNSVKDSARIPPDGSMGSITCIAWKG
DTLVLGDMDGNLNFWDLKGRVSRGIPTHRSWVKKIRFAPGKGNQKLIAMYNDGAEVWDTK
EVQMVSSLRSGRNVTFRILDVDWCTSDKVILASDDGCIRVLEMSMKSTCFRMDEQELTDP
VWCPYLLVPRAALALKAFLLHQPWSGQYSLDISCVDYPENEEIKNLLQEQLNSLSNDIKK
LLLDPDFTLLQRCLLVSRLYGDESELHFWTVAAHYLHSLSQEKSASTTATKEAVSRDKLS
NPLDICYDILCENAYFQKFQLERVNLQEVKRSTYDHTRKCTDQLLLLGQTDRAVQLLLET
SADNQHYYCDSLKACLVTTVTSSGPSQSTIKLVATNMIANGKLAEGVQLLCLIDKAADAC
RYLQTYGEWNRAAWLAKVRLNSEECTDVLKRWVDHLCSPQVNQKSKALLVLLSLGCFYSV
AETLHSMRYFDRAALFVEACLKYGAFEVTEDTEKLIAAIFADYARSLKNLGFKQGAVHFA
SKAGAAGKDLLKELESTKEEPTEE
Download sequence
Identical sequences ENSMICP00000008105 ENSMICP00000008105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]