SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008165 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008165
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily DNA-binding domain 3.6e-16
Family Methyl-CpG-binding domain, MBD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008165   Gene: ENSMICG00000008970   Transcript: ENSMICT00000008965
Sequence length 233
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1903:251609:315246:-1 gene:ENSMICG00000008970 transcript:ENSMICT00000008965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPD
LNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQ
IIKTMELPKGLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
Download sequence
Identical sequences ENSMICP00000008165 ENSMICP00000008165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]