SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008403 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008403
Domain Number 1 Region: 307-455,499-557
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-42
Family Eukaryotic proteases 0.00000115
Further Details:      
 
Domain Number 2 Region: 102-210
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-31
Family Kringle modules 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008403   Gene: ENSMICG00000009222   Transcript: ENSMICT00000009227
Sequence length 560
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_354:40115:67443:-1 gene:ENSMICG00000009222 transcript:ENSMICT00000009227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAEMRTELLCVLLLWGAVFPSPSQEVHARFRRGGRSFQVTCRDEKTQMXXXXXXXXXXXX
XXXXRMKCSFCRLKCHPSPVGSCSEPKCFNSGTCLQALYFSDFVCQCPEGFAGKRCEIDT
RATCYEDQGASYRGTWSTAESGAQCVSWNSSALARKPYNGRRPDAPRLGLGNHNYCRNPD
QDSKPWCYVFKAGRYSSEFCSTPACSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTCGLRE
HRQPQLRIKGGLFADIASHPWQAAIFVRNRRAPGETFLCGGVLIAPCWVLSAAHCFQDRF
PPHHLKVVLGRTYRLVPGEEEQRFEVEKYIVHEEFDDDTYNNDIALLQLRSDDAPRCARE
SRSVRAACLPEAALQLPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXGDSGGPLVCLKDNRMTLVGIISWGLGCGQKDV
PGVYTKVTRYLDWIRDNARP
Download sequence
Identical sequences ENSMICP00000008403 ENSMICP00000008403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]