SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008523 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008523
Domain Number 1 Region: 7-44,196-276
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000846
Family Glyoxalase I (lactoylglutathione lyase) 0.056
Further Details:      
 
Domain Number 2 Region: 3-93
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000546
Family Glyoxalase I (lactoylglutathione lyase) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008523   Gene: ENSMICG00000009361   Transcript: ENSMICT00000009361
Sequence length 313
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2233:227996:246726:-1 gene:ENSMICG00000009361 transcript:ENSMICT00000009361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRALHFVFKVGNRFQTARFYRDVLGMKDTMSHFVARLECRGVSLAHSFDYWRREDSF
SKPYDGRWSKTMVGFGPEDDHFVVELTYNYGIGXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXCKLELQGIKSVVDHAAAFGRIAFSCPQKELPGLEDLMKRENQKI
LTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSD
EWFAKHNKPKASG
Download sequence
Identical sequences ENSMICP00000008523 ENSMICP00000008523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]