SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008661 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008661
Domain Number 1 Region: 6-436
Classification Level Classification E-value
Superfamily ALDH-like 4.45e-99
Family ALDH-like 0.00000000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008661   Gene: ENSMICG00000009516   Transcript: ENSMICT00000009517
Sequence length 468
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1111:26182:38257:1 gene:ENSMICG00000009516 transcript:ENSMICT00000009517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFEDTLRRLREAFSAGRTRPAEFRAEQLRGLGRFLQDNKQLLQDALAQDLHKSAFESE
LSEIAISQSEVTLALRNLRAWMKDQRAHKNLATQLDSAFIRKEPFGLVLIVAPWNYPLNL
TLVPLVGALAAXXXXXXXXXXXSTSVEKVLAELLPRYLDQSCFAVVLGGPQEMGQLLEHR
FDYIFFTGSPRVGRIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNA
GQTCVAPDYILCSPETQERLLPALQSAITRFYGDDPQSSPNLGRIINQKQFQRLRALLGC
GRVAIGGQSDESQRYIAPTVLVDVRETEPVMQEEIFGPILPIVNVRSLDEAIDFINRREK
PLALYAFSNSSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASGMGRYHGKFSFD
TFSHHRACLLRSPRMEKVNDLRYPPHSQRNLRVLLVAMEAHCCSCTLL
Download sequence
Identical sequences ENSMICP00000008661 ENSMICP00000008661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]