SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008872 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008872
Domain Number 1 Region: 397-497
Classification Level Classification E-value
Superfamily E set domains 3.6e-26
Family Filamin repeat (rod domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 185-243
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000733
Family B-box zinc-binding domain 0.004
Further Details:      
 
Domain Number 3 Region: 26-59,94-102
Classification Level Classification E-value
Superfamily RING/U-box 0.000000393
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000008872
Domain Number - Region: 225-327
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0017
Family Apolipoprotein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008872   Gene: ENSMICG00000009751   Transcript: ENSMICT00000009743
Sequence length 580
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1914:336848:345469:-1 gene:ENSMICG00000009751 transcript:ENSMICT00000009743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSENRKPLLGFVSKVPSGTALGNSGKTHCPLCMGLFKAPRLLPCLHTVCTTCLEQLEPFS
VVDLRGGDSDTSSEGSIFQELKPRSLQPQIGILCPVCDAQVDLPMGGVKALTIDHLAMND
VMLESLRGEGQGLVCDLCSDREVEKRCQTCKANLCHFCCQAHRRQRKTTYHTMVDLKDLK
GYSRIGKPILCSAHPAEELRLFCELCDRPVCRDCVVGEHREHPCDFTSNVIHKHGDSVRE
LLKGTQPHVEALEEALDQIKRMNGALQQRVEAVAANVRTFSEGYIKAIEEHRDKLLKQLE
DIRVHKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKGVVVERLRKLNKV
EYSARPGVNDKICFSPQEKAGLCHGYEVYGTINTKEVDPAKCVLQGEDLHKAREKQTASF
TLLCKDAMGESMGRGGDNVQVAVVPKDKKDSPIRTMVQDNKDGTYSVSFTPKEPGVYTVW
VCIKEQHVQGSPFTMTVRRKHRPHAGVFHCCTFCSSGGQKTARCACGGTMPGGYLGCGHG
HKGHPGRPHWSCCGKFNEKSECTWVGGQSTPRSLLRTVAL
Download sequence
Identical sequences ENSMICP00000008872 ENSMICP00000008872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]