SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008888 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008888
Domain Number 1 Region: 50-193
Classification Level Classification E-value
Superfamily Carbonic anhydrase 7.59e-40
Family Carbonic anhydrase 0.0000971
Further Details:      
 
Domain Number 2 Region: 267-304
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.00000222
Family Carbonic anhydrase 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008888   Gene: ENSMICG00000009759   Transcript: ENSMICT00000009761
Sequence length 325
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2749:88196:539529:-1 gene:ENSMICG00000009759 transcript:ENSMICT00000009761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RARIRSCSCGTEPDELFMVGVKEDPQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSA
WNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVN
ISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSP
NGLVVVSIFIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRC
IRTNINFSLQGKDCPNNRAQKLQYR
Download sequence
Identical sequences ENSMICP00000008888 ENSMICP00000008888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]