SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008941 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008941
Domain Number 1 Region: 49-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.06e-69
Family Carbonic anhydrase 0.000000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008941   Gene: ENSMICG00000009828   Transcript: ENSMICT00000009819
Sequence length 315
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_424:4454:41733:1 gene:ENSMICG00000009828 transcript:ENSMICT00000009819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMNSLRVILQAAPYKLLWRKFQIPRSVPVRPCSLYTCTYKTRNRTLHPLWESVDLAPAG
DRQSPINIRWRDSVYDPGLKPLTISYDPTTCLHVWNNGYSFLVEFEDSTDKSVIEGGPLE
HNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFETFEDAALEENGLAVIG
VFLKLGKHHKELQKLVNTLPSIKHKDTLVEFESFDPSCLMPTCPDYLDYSGSLTTALAES
VTWIIKKQPVEVDHDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSSFRHDCVL
NMQAKPKPATSQATP
Download sequence
Identical sequences ENSMICP00000008941 ENSMICP00000008941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]