SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009296 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009296
Domain Number 1 Region: 6-386
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.53e-152
Family Phosphoglycerate kinase 0.00000000000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009296   Gene: ENSMICG00000010214   Transcript: ENSMICT00000010210
Sequence length 387
Comment pep:known_by_projection scaffold:micMur1:scaffold_35478:1496:2663:-1 gene:ENSMICG00000010214 transcript:ENSMICT00000010210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PMKEITNTKIKASIPSIKYCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAAELKSLLG
KEVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGKGQDPSGKKLKAEPNQIEAF
RASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKASGFLMKKELEYFAKALENPEKPFLA
ILGGAKVADKIQLIKNMLDKVNEMIIGGGMAFTFLKVLNNMEIGASLFDEEGAKIVKDIM
AKATKNGVTITFPVDFVTADKFDEKAQVGQATVASGIPSGWMALDCGPESNKKHAEIVAR
AKLIVWNGPLGVFEWDNFSKGTKSLMDEIVKATSKGCVTIIGGGDTATCCAKWNTEDKVS
HVSTGGGASLELLEGKVLPGVEALSNV
Download sequence
Identical sequences ENSMICP00000009296 ENSMICP00000009296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]