SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009309 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009309
Domain Number 1 Region: 90-234,480-593,642-744
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.57e-50
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 
Domain Number 2 Region: 200-447
Classification Level Classification E-value
Superfamily Nucleoporin domain 0.0000000000000034
Family Nucleoporin domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009309   Gene: ENSMICG00000010207   Transcript: ENSMICT00000010223
Sequence length 1491
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_960:401152:432659:1 gene:ENSMICG00000010207 transcript:ENSMICT00000010223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGPGGYARSDAVEKLSSVTAGVPARRGQPSPPPAPPLCLRRRTRLPAAPEDTVHNRV
SLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVILNPKENKQQHIFNTARKSLSAVAFS
PDGKYIVTGENGHRPAVRIWDVEEKSQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDILVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTEIKVMGTVPL
VGRSGILGELHNNIFCGVACGRGRMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQELIFCGCTDGIVRIFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFQKKAEAVYP
DTVALTFDPVHQWLSCVYRDHSIYIWDVKDINQVGKMWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNMDSSPDSHWQKNIFSNTLLKVVYVENDIQHLQDTSHFPD
RGSENATPMDVKAGVRVMQVSPDGQHLASGDRSGNLRQHCLHFMDELVKVEAHDAEVLCL
EYSKPETGLTLLASASRDRLIHVLNAEKNYNLEQTLDDHSSSITAIKFAGNRDIQMISCG
ADKSIYFRSAQRASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNG
KQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECVAKMFGHSEIITG
MKFTYDCRHLITVSGDSCVFIWHLGPEITNCMKQHLLEINQREQQQHTKDRKWSSHPRQE
TYASLPRDHLSEQDLEECEPEELLKTPFRDSLDPDPRCLLTNGKLPLWAKRLLGDEDAAD
GSAFHGKRSYQPHGRWAERAGQEPLKTILDARDLDCYFTPMKPESLEDSVLDTVEPQNLA
GLLSESESPQEGGCRRPSFPKQRESPEASELVYSLEAEVTVTGTDSEYCEKEVEEGLGDQ
HSDSYLRVSSVSSKDQSPPEDSGESEADLECISATAHPSPPRPDPDSRFAMATPPTPGCP
GTGELSQPEGPGMCTSSLPQTPEQEKFLRHHFETLTDSHPEALRDMKVSEAEDYYNPRLS
ISAQFLSSLRKTSRLPHRLPQRLVTSPEVKPTARRRSQPRAEPESVLSGRKVEAALCPLP
CLSALAPRVPPSSVLPTDRKPPTPTSAPSPGLAQGIHVPSTCSYMEATASSRAKMACSIS
LGDSEGPVMAELARPLGRPSSMGELASLGQELQAITTTATPSSGSKGQEPAMHSWGNHDA
RAGLRLTLSSVCDRPLEPPVDPQPGITVTTASFRAPSPVDASALKPHSSALLPRLPACEP
LDPAACSSSPQLPEARPGVPGSTVSPLEHCPDALSLHRSSPRSWSEPGVPAEVLSPAPLE
LSSVGDILHRLQTAFQEALDLYHVLVSSDQVDAEQQQVQTELASTFLWIHSQLEASDWLV
GTDVAPAQGLPSPGPPSPPAACPLGSPDLHALLEHYSELLVQAVRRKARGD
Download sequence
Identical sequences ENSMICP00000009309 ENSMICP00000009309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]