SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009336 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009336
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily UBC-like 9.83e-63
Family UBC-related 0.000000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009336   Gene: ENSMICG00000010253   Transcript: ENSMICT00000010251
Sequence length 146
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_377:26412:58172:1 gene:ENSMICG00000010253 transcript:ENSMICT00000010251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDY
PFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
DIAQIYKSDKKKYNRHAREWTQKYAM
Download sequence
Identical sequences ENSMICP00000009336 ENSMICP00000009336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]