SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009425 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009425
Domain Number 1 Region: 12-350
Classification Level Classification E-value
Superfamily UROD/MetE-like 7.5e-113
Family Uroporphyrinogen decarboxylase, UROD 0.00000000000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009425   Gene: ENSMICG00000010346   Transcript: ENSMICT00000010347
Sequence length 350
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1632:25507:28671:1 gene:ENSMICG00000010346 transcript:ENSMICT00000010347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVNGFGPKSFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREERDLER
LRDPAVVASELDYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSNTMARAKRW
LYQRPQASHQLLRILTDALVPYLVGQVAAGAQALQLFESHAGHLGPELFSKFALPYIRDV
AKRVKAGLQKAGLASVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARERVGKMVT
LQGNLDPCALYASKEEIGQLVQQMLDDFGPQCYIANLGHGLYPDMDPEHV
Download sequence
Identical sequences ENSMICP00000009425 ENSMICP00000009425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]