SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009633 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009633
Domain Number 1 Region: 409-507,661-792
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.58e-32
Family Phosphate binding protein-like 0.000000706
Further Details:      
 
Domain Number 2 Region: 100-376
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.68e-22
Family L-arabinose binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009633   Gene: ENSMICG00000010565   Transcript: ENSMICT00000010577
Sequence length 1234
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3625:227623:277006:-1 gene:ENSMICG00000010565 transcript:ENSMICT00000010577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGALGPALLLTSLLGAWAGPGPGQGTQAVTVAVVFGSSGLPQAQARARLTPQSFLDLPL
EIQPLTVGVNNTNPSSLLTQICSLLGAARIHGIVFEDNVDTEAVAQILDFISSQTHVPIL
SISGGSALVLSPKEPGSAFLQLGVSLQQQLQVLFKVLEEYDWSAFAVITSLHPGHTLFLD
GVRAAADASHLSWRLLDVLTLELGPGGPRARTQRLLRQLDAPVFLAYCSREEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDSPPAAFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HGYRRQHGALPAAAADCRGHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLFQPTMVV
IALNRHRLWEMVGRWEHGVLHMKYPVWPRYSASLRPVVDSRDLTGATLEERPFGFVRPGP
GTGRLGCIASCRMNRQIFASSDVAPYTKLCCKGFCIDILKKLAKVVKFSYDLYLVTNGKH
GKRVRGVWNGMIGEVYYKRADMAIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKKPGGPSFTIGKSV
WLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYXXXXXXXXXXXXXXXXXXXX
SDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHSHMVKFNQRSVEDALTSLKMGKL
DAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQFLGD
GETQKLETVWLSEICQTEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVYWKL
RHSVSSTSQLDFLLAFSRGIYSCFNGVQSLASPPQPPSPDLTASSAQASVLKMLQAARDM
VTTAGVSSSLDRATRTIENWGGGLRAPPPPNCPAPQPRPGPRPSSPGPPPEPSPRDCGPP
GAGRAALVRRAPKPPGRPPTAGSPLPDNPRVSRRPVWEARWPVRTRHCGRHLSASERPLS
PACCHYSSFPRADRSGRPFLPLFPEPPEPEDLPLLGPEQLARREALLRAAWARGSRPRHA
SLPSSVAEAFTQPSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXCWGVVCPHSPLCASLNSLTGRAGGPPGHRGRTLGLSTSYR
DSGGLAEVSRVACGTQGFLGPCTWRRISSLESEV
Download sequence
Identical sequences ENSMICP00000009633 ENSMICP00000009633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]