SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009643 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009643
Domain Number 1 Region: 81-309
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-52
Family C-terminal domain of adrenodoxin reductase-like 0.00000000546
Further Details:      
 
Domain Number 2 Region: 5-134,324-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000111
Family C-terminal domain of adrenodoxin reductase-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009643   Gene: ENSMICG00000010591   Transcript: ENSMICT00000010588
Sequence length 438
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3625:284591:288625:-1 gene:ENSMICG00000010591 transcript:ENSMICT00000010588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPQAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTAHSDRCAFWGNVEVGRDVTV
PELQEAYHAVVLSYGAEDHQALDIPGEELPGVFSARSFVGWYNGLPENQELAPDLSCDTA
VILGQGNVALDVARILLTPPEHLEALLLCQKTDITKAALGVLRQSQVKTVWLVGRRGPLQ
VAFTIKELREMIQLPGTRPILDPEEFLGLQDRIKEIPRPRKRLTELLLQTATQKPRAEEA
AHLASGSRAWGLRFFRSPQQVLPSPDGRRVAGIRLAVTRLEGVGEAIRAVPTGDMEDLPC
GLVLSSIGYKSRPIDPSVPFDLKLGVIPNMEGRVVDVPGLYCSGWVKTGPTGVIGTTMND
SFLTGQMLLQDLKSGLLASGPRPGSAAIQALLSSRGVRPVSFSDWEKLDAKEVAQGQGSG
KPREKLVDRQEMLRLLGR
Download sequence
Identical sequences ENSMICP00000009643 ENSMICP00000009643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]