SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009750 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009750
Domain Number 1 Region: 460-709
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-58
Family Eukaryotic proteases 0.000048
Further Details:      
 
Domain Number 2 Region: 367-460
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-34
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 3 Region: 280-364
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-30
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 4 Region: 234-273
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000179
Family Kringle modules 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009750   Gene: ENSMICG00000010687   Transcript: ENSMICT00000010698
Sequence length 711
Comment pep:novel genescaffold:micMur1:GeneScaffold_3652:157248:163416:-1 gene:ENSMICG00000010687 transcript:ENSMICT00000010698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWLPLLLLLTKCSGVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYC
RNPDGSERPWCYTMDPQIKREFCDLPRCGSEAQPRHEATTLNCFRGKGEGYRGTANTTTA
GVPCQRWDAQSPHQHRFAPEKYACKDLRENFCRNPDGSEAPWCFTSRPGMRMAFCYQIRR
CPDDVRTEDCYHGAGEQYRGTVSKTRKGVQCQHWSAQTPHRPQFTPTLAPHSQLEENFCR
NPDRDSHGPWCYTVDPGTPFDYCALQRCNDDHPPSILDPPDQVLFEKCGKRVDRLDQHRS
KLRVVGGQPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCFSSCHMALTGYEVWLGT
LFQDPQPEEPGLQRVPVAKMVCGPSGSQLILLKLERSVTLNQRVALICLPPERYVVPPGT
KCEIAGWGESKGTGDGTVLNVALLNVISNQECNIKHRGRVRESEMCTKGLLAPVGACEGD
YGGPLACFTHDCWVLEGIIIPNRVCARPRWPAVFMRVSVFVDWIHKVMRLG
Download sequence
Identical sequences ENSMICP00000009750 ENSMICP00000009750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]