SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009782 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009782
Domain Number 1 Region: 127-201,243-334
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000842
Family C-terminal domain of adrenodoxin reductase-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009782   Gene: ENSMICG00000010736   Transcript: ENSMICT00000010735
Sequence length 427
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3197:3901:20894:1 gene:ENSMICG00000010736 transcript:ENSMICT00000010735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLVEETSLLEDSSVTLPVVIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXPPGGACHNMEGSMLTISFGNWMELPGLKFKDWVSSKRRNLKGDRVMPEEIARYYK
HYVKVMGLQKNFRENTYITSVSRLYRDQDDDDSQDRDISTKHLQIEKSKFIKRNWEIRGY
QRIADGSHVPFCLFAENVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAISKGKLRGK
VDPVLIVGSGLTAADAVLCAYNNNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMM
CTQSYSVNSNLLSDYTSFPEHHVLSFKSDMKCILQSISGLKKIFKLSAAAVLIGSHPNLS
FLKEQGC
Download sequence
Identical sequences ENSMICP00000009782 ENSMICP00000009782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]