SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010200 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010200
Domain Number 1 Region: 411-524,644-781
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-62
Family Phosphate binding protein-like 0.000000326
Further Details:      
 
Domain Number 2 Region: 136-294,343-389
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000000000109
Family L-arabinose binding protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010200   Gene: ENSMICG00000011188   Transcript: ENSMICT00000011200
Sequence length 951
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2072:523613:830855:1 gene:ENSMICG00000011188 transcript:ENSMICT00000011200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVLAPLVLLPVWLVMVACSPHSLRIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXDSEYETAETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPHFK
VPEFVKFQFQRFTTLNLHPSNDISVVAILNFFNCTTACLICAKAECLLNLEKLLRQFLIS
KDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAYYTYIF
TNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFSQSLNQSWQENCDHAPFTGPAXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVELEGLTGHIEF
NSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSRLYASNISDSLFNTTLVVTTILE
NPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTWTGM
VGELIARKADLAVAGLTITAEREKVIDFSKPXXXXXXXXXXXXXXGRKPGYFSFLDPFSP
GVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGGFM
QQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQTAI
EYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLLEST
MNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRKWWE
GGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTATLSNGKLCGAGEPDQLAQRL
SQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLDWEKTTNSSEPE
Download sequence
Identical sequences ENSMICP00000010200 ENSMICP00000010200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]