SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010330 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010330
Domain Number 1 Region: 516-709
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.24e-59
Family Hemopexin-like domain 0.0000000174
Further Details:      
 
Domain Number 2 Region: 91-216,390-445
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.84e-32
Family Matrix metalloproteases, catalytic domain 0.000000905
Further Details:      
 
Domain Number 3 Region: 337-391
Classification Level Classification E-value
Superfamily Kringle-like 1.68e-21
Family Fibronectin type II module 0.00013
Further Details:      
 
Domain Number 4 Region: 275-332
Classification Level Classification E-value
Superfamily Kringle-like 4.85e-21
Family Fibronectin type II module 0.0000918
Further Details:      
 
Domain Number 5 Region: 219-274
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-20
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 6 Region: 33-105
Classification Level Classification E-value
Superfamily PGBD-like 1.41e-17
Family MMP N-terminal domain 0.0000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010330   Gene: ENSMICG00000011348   Transcript: ENSMICT00000011345
Sequence length 710
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3891:265513:271876:1 gene:ENSMICG00000011348 transcript:ENSMICT00000011345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPWQPLVLALLVLGCCSAGPLRQRQPTVVVFPSDLRSNLTDRQLAEEYLYRYGYSRVAE
MRGETLSMRSSLLLLQKHLSLPETGELDSTTLKAMRAPRCGVPDVGRFQTFEGDLKWHHY
NITYWIQNYSEDLPRSVIDEAFARAFAVWSAVTPLTFTRVYGRDADIVIQFGVDEHGDGY
PFDGKDGLLAHAFPPGPGIQGDAHFDDAELWSLGKGVVVPTYYGNADGAPCHFPFTFEGR
SYSACTTDGRSDDTPWCSTTADYDTDRKFGFCPSERLYTQDGNADGKPCQFPFIFEGKSY
SACTTDGRSDGYRWCATTGNYDQDRLYGFCPTRADSTVIGGNAAGELCVFPFVFLGKQYS
TCTSEGRNDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHTSVPEALM
YPMYRFTEEPPLHADDVKGIQHLYGPRPEPDPRPPATTTPEPRPTAPATACPTGPPTARP
SERPTAGPTGPPAAGPTGPPTAGPPTAPTVSLDPADDACNVNIFDAIAEIGNRLHFFKDG
RYWRFSDGRGRRLQGPFLIADSWPALPRKLDSAFEEPLSKKVFFFSGRQVWVYTGTSVLG
PRRLDKLGLGSEVTHVTGALPRGGGKVLLFSGQHFWRFDGKTQTVDSRSATPVDQMFPGV
PLNTHDIFQYQEKAYFCQDRFYWRVSSRNEVNQVDLVGYVTYDILQCPEY
Download sequence
Identical sequences ENSMICP00000010330 ENSMICP00000010330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]