SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010392 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010392
Domain Number 1 Region: 158-398
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-80
Family ALDH-like 0.00001
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily ALDH-like 7.2e-30
Family ALDH-like 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010392   Gene: ENSMICG00000011418   Transcript: ENSMICT00000011416
Sequence length 400
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1188:108923:138898:1 gene:ENSMICG00000011418 transcript:ENSMICT00000011416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKPLKEAQSEIVYSALFLEWFSEEARRIYGDIIYTSAKDKRALVLKQPIGVAAIITPWNF
PSAMITRKVGAALAAGCTVVVKPAEDTPLSALALAEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILLHYAANSVKKVSLELGGHAPF
IVFDSANVDQAVAGALASKFRNSGQTCVCTRFLVQRGIHDFVKEFAAAMKKSLRVGNGFE
EGSTQGPLINEKAVEKVEKHVSDAVSKGATVVTGGKRHQLGKNFFEPTLLSNVTQDMLCS
HEETFGPLAPVIKFDTEEEAVAIANATDVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEG
LISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCFGGL
Download sequence
Identical sequences ENSMICP00000010392 ENSMICP00000010392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]