SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010511 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010511
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily C-type lectin-like 6.47e-26
Family C-type lectin domain 0.0000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010511   Gene: ENSMICG00000011560   Transcript: ENSMICT00000011555
Sequence length 107
Comment pep:novel scaffold:micMur1:scaffold_11175:4:1284:1 gene:ENSMICG00000011560 transcript:ENSMICT00000011555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FISGEVKTWEESRIFCISQNSSLLQLQNRDELASAFMYSNQYFYWIGLSYNTERGDWQWE
DGSNFSRNLFSSFETPDPKNCIVYDAMKSAVDEPCERQNHFICKKLI
Download sequence
Identical sequences ENSMICP00000010511 ENSMICP00000010511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]