SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010552 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010552
Domain Number 1 Region: 90-121
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 0.00000000222
Family Nucleoplasmin-like core domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010552   Gene: ENSMICG00000011600   Transcript: ENSMICT00000011597
Sequence length 217
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2488:130293:141703:1 gene:ENSMICG00000011600 transcript:ENSMICT00000011597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLSSTSSTAEKTVTTVLWGCELSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTMMRFELSPPVTFQLRAGSGPVFLSGQEC
YETSDLTWDEEESEEEEAEEEEEEEEEDEDEDIDISVEEDTPVKHAKRPSSSQKQMSVAK
KKKLEKEEEAARPSARDKSPMRKAKPTLKPKKPGSKK
Download sequence
Identical sequences ENSMICP00000010552 ENSMICP00000010552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]