SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010666 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010666
Domain Number 1 Region: 418-896
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-161
Family ALDH-like 0.000000000805
Further Details:      
 
Domain Number 2 Region: 7-207
Classification Level Classification E-value
Superfamily Formyltransferase 4.71e-49
Family Formyltransferase 0.0000000176
Further Details:      
 
Domain Number 3 Region: 211-311
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 7.22e-26
Family Post formyltransferase domain 0.000013
Further Details:      
 
Domain Number 4 Region: 329-417
Classification Level Classification E-value
Superfamily ACP-like 0.0000222
Family Acyl-carrier protein (ACP) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010666   Gene: ENSMICG00000011711   Transcript: ENSMICT00000011718
Sequence length 897
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4505:694796:735773:-1 gene:ENSMICG00000011711 transcript:ENSMICT00000011718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGKADPLALAAEKDGTPVF
KFPRWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDVIDGPKHGSIIYHPSILPRHR
GASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPNDTVDALYNRFLFPEGIK
AMVEAVQLIADGKAPRVPQPEEGATYEGIQKKENAEISWDQSAEVLHNWIRGHDKVPGAW
TEINGQMVTFYGSTLLNSSVPSGEPLEIKGAKKPGLVTKSGLVLFGNDGKALMVRNLQFE
DGKMIPASQYFSAGETSVVELTAEEVKVAEIIKVIWAGILSNVPVIEDSTDFFKSGASSM
DVVRLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGEDQEAELVVDYVSKEVNE
MTVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLVDVDKAVAAAKDAFENG
EWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLALKTHIGMSVQTFRYFAG
WCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLAAGNTLV
LKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSHPDIRKLGFTGSTPIGKQIMKSCAVS
NLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAVFFNKGENCIAAGRLFVEESIHDEFVT
RVVEEIRKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCEAGVKEGATLVYGGRQVQRPGFF
MEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGDIDGVLRRANDTEYGLASGVFTKDINK
AMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSGFGKDLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences ENSMICP00000010666 ENSMICP00000010666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]