SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010893 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010893
Domain Number 1 Region: 193-369
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.55e-18
Family Voltage-gated potassium channels 0.011
Further Details:      
 
Domain Number 2 Region: 455-545
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000087
Family cAMP-binding domain 0.004
Further Details:      
 
Domain Number 3 Region: 61-106
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000907
Family Flavin-binding PAS domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000010893
Domain Number - Region: 839-875
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0824
Family Mitotic arrest deficient-like 1, Mad1 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010893   Gene: ENSMICG00000011961   Transcript: ENSMICT00000011964
Sequence length 988
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4215:490197:519577:-1 gene:ENSMICG00000011961 transcript:ENSMICT00000011964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTELKRSPTSASQRARYRRETAPGLLYLFLLPFQKAL
GHEHRAEICFYRKDGSAFWCLLDMLPIKNEMGEVVLFLFSFKDITQSGSPGLGPQGGHGD
SNHENSLGRRGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVFEPKPSVPEYKV
ASVGGARCLLLHYSVPKAIWDGLILLATFYVAVTVPYNVCFSGDDDSPITSRNTLVSDIA
VEMLFILDIILNFRTTYVSQSGQVISAPRSIGLHYLATWFFVDLIAALPFDLLYVFNITV
TSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLTLLMSVFALLAHWMACIWYVIGRREME
ANDPLLWDIGWLHELGKRLEVPYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXLMHAVVFGNVTAIIQRMYSRRSLYHSRMKDLKDFIRVHRLPRPLK
QRMLEYFQTTWAVNSGIDANELLRDFPDELRADIAMHLNREILQLPLFGAASRGCLRALS
LHIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGDLIGADIPEPGQE
PGSGTGPSCVLKTSADVKALTYCGLQQLSSQGLAEVLRLYPEYGAAFRASLPRDLTFNLR
QGSDTSGLGRFSRSPRLSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXIVDGIEDSGSTAEASTFRFSRRPEHPRPRSQAPPTGTRPSWET
ATEAEEVKEKVCKLNQEISRLNQEVSQLSRELRHMMGLLQARLCPSGHPTVSAWPPGPPC
PQLRPPHISPCVSRPPPSLQDTTFAEVHCPATVGTAEMGAAPVDLRPSMLPPYPSEPDPL
GPSPVPEASPSTPSLTRHSFRSRSDTFH
Download sequence
Identical sequences ENSMICP00000010893 ENSMICP00000010893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]