SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010934 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010934
Domain Number 1 Region: 128-314
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.45e-35
Family Glutamine synthetase catalytic domain 0.0055
Further Details:      
 
Domain Number 2 Region: 19-125
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 8.11e-19
Family Glutamine synthetase, N-terminal domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010934   Gene: ENSMICG00000012010   Transcript: ENSMICT00000012008
Sequence length 327
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2443:193393:265459:-1 gene:ENSMICG00000012010 transcript:ENSMICT00000012008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTRDINQILTTPQLSSRMKYIKQAMAKNHLQFVRFEATDLHGVSRSKSIPAHFFQXXXVH
GVYMPRGYLELIPNPRDNEVNHIRATCFNSDIVLMPELSTFRVLPWAERTARVICDTFTV
TGEPLLTSPRYIAKRQLNQLQDSGFSLLSAFIYDFCIFGVPEIINSKTISFPATTLLNDH
DQPFMQELVYGLYHTGANVESFSSSTRPGQMEICFLPEFGISSADNAFTLRTGVEDVARK
YNYIASFFVETGFCNSGILSHSLWDVGGKRNLFCHSSGTEQLTVTGRKWLAGLLKHSAAL
SCLMAPAVSCRKRYESTDLRDSVPTWG
Download sequence
Identical sequences ENSMICP00000010934 ENSMICP00000010934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]