SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010941 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010941
Domain Number 1 Region: 26-229
Classification Level Classification E-value
Superfamily PHP domain-like 4.71e-42
Family RNase P subunit p30 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010941   Gene: ENSMICG00000012019   Transcript: ENSMICT00000012018
Sequence length 268
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2531:344234:372092:1 gene:ENSMICG00000012019 transcript:ENSMICT00000012018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFADLDLRVGSXXXXXXXXXXXXXXXGYSVVAINHVVDFKEKKQEIEKPVAVSELFTT
LPVVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHL
DVDLVCITVTEKLPFYFKRPPINVAIDRGLGFELVYSPAIKDSTMRRYTISNALNLMQVC
KGKNVIISSAAERSLEIRGPYDVANLGLLFGLSESDAKAAVSTNRRAALLHGXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEG
Download sequence
Identical sequences ENSMICP00000010941 ENSMICP00000010941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]