SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010957 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010957
Domain Number 1 Region: 7-405
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-72
Family ALDH-like 0.0000485
Further Details:      
 
Domain Number 2 Region: 449-506
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000323
Family ALDH-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010957   Gene: ENSMICG00000012040   Transcript: ENSMICT00000012035
Sequence length 522
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3855:34740:50306:-1 gene:ENSMICG00000012040 transcript:ENSMICT00000012035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSPERDALQKALKDLKGRTEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKGL
LNKAIEAALAARKEWDLKPVADRAQIFLKAADMLSGPRRAEVLAKTMVGQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTNRVVYRGLEGFVAAISPFNFTAIGGNLAG
APALMGNVVLWKPSDTAMLASYAVYRVLREAGLPPNIIQFVPADGPTFGDTITSSEHLCG
INFTGSVPXXXXXXXXXXXXXXXXXXXXXXXXXCGGKNFHFVHRSADVDSVVSGTLRSAF
EYGGQKCSACSRLYVPRSLWPQIKARLLEEHGRIRVGDPAEDFGTFFSAVIDAKSFGRIK
KWLEHARSSPSLSVLAGGRCDDSVGYFVEPCIVESKDPQEPIMKEXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXDVIREATQVLRNAAGNFYINDKSTGSVVGQQPFG
GSRASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYMQ
Download sequence
Identical sequences ENSMICP00000010957 ENSMICP00000010957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]