SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011014 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011014
Domain Number 1 Region: 781-872
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000156
Family Canonical RBD 0.021
Further Details:      
 
Domain Number 2 Region: 11-54
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000053
Family LEM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011014   Gene: ENSMICG00000012102   Transcript: ENSMICT00000012101
Sequence length 912
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1888:815332:883591:1 gene:ENSMICG00000012102 transcript:ENSMICT00000012101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQHRSGGR
GNKTRNSNNNNTAAATVAAAGPAVAAAVGMGVRPVSGDLSYLRTPGGLGRMSASGPESLL
GGPGGASAAPAAGSKVLLGFSSDESDVEASPRDQAGGGGRKDRASLQYRGLKAPPAPLAA
SEVTNSSSAERRKPHSWWGARRPAGSELQTPSGKDGAVEDEEGEGEDSEDRDPEAEEPLW
ASRTVNGSRLVPYSCRENYSDSEEEGDDDVASARQVLKDDSLSRHRPRRTHSKPLSPLTA
KSAGSRLETSVQGGGGLAMNDRAAAAGSLDRSRNLEEAAAAEPGGGCDQVDSSPIPRYRV
NAKKLAPLLPPPLTDMDSTLDSSTGSLLKTNNHIGGGVFSVDSPRIYSNSLPPSAAVAAS
SSLRINHANHTGSNHTYLKNTYNKPKLSEPEEELLQQFKREEVSPTGTFSAHYLSMFLLT
AACLFFLILGLTYLGMRGTGVSDDGGLSIENPFGETFGKIQESEKNLMMSTLYKLHDRLA
QLAGDHECGSSSQRTLSVQEAAAYLKDLGPEYENIFNTSLQWILENGKDVGIRCVGFGPE
EELTNITDVQFLQSTRPQMSFWCRFRRAFITVTHRLLLLCLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHLDRRNSPP
NSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCL
SPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTCNTPLKPSNKHMNSMSHLR
LRTGLANSQGGS
Download sequence
Identical sequences ENSMICP00000011014 ENSMICP00000011014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]