SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011342 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011342
Domain Number 1 Region: 45-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.78e-54
Family Alanine racemase-like, N-terminal domain 0.000000146
Further Details:      
 
Domain Number 2 Region: 249-380
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0000000000544
Family Eukaryotic ODC-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011342   Gene: ENSMICG00000012460   Transcript: ENSMICT00000012458
Sequence length 436
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_11:147981:210577:1 gene:ENSMICG00000012460 transcript:ENSMICT00000012458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSESDFVMVEEGFSTRDLLEELTLGASQATTGDVAAFFVADLGAVVRRHFCFLKCL
PRVRPFYTVKCNSSPGVLKVLAELGLGFSCANKAEMELVQHIGIPASKVIYTNPCKQIAQ
IKYAAKHGIRLLSFDNEMELAKVVKSHPSAQMVLCIATDDSHSLSRLSLKFGASLESCRH
LLENAKRSHVEVVGVXXXXXXXXXXXXXXXXXXADARLVFEMGTELGHRMHILDLGGGFP
GMEGDKVRFEEIASVINSALDLYFPEGCGVDILAELGRYYVTSAFTMAVSIIAKKEALLD
QPGREAPLSSPHTAACAAAPSPPAEENGSAPKTIVYHLDEGVYGIFNSVLFDNICPTPIL
QKKSSTEQPLYSSSLWGPGDDGCEWVGDILWEVLRGQLLPAEQDEDAEGVCKPLSCGWEI
TDTLCVGPVFTPASIM
Download sequence
Identical sequences ENSMICP00000011342 ENSMICP00000011342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]