SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011393 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011393
Domain Number 1 Region: 44-281
Classification Level Classification E-value
Superfamily PLP-binding barrel 9.91e-51
Family Alanine racemase-like, N-terminal domain 0.00000000938
Further Details:      
 
Domain Number 2 Region: 245-339
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 7.12e-17
Family Eukaryotic ODC-like 0.0000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011393   Gene: ENSMICG00000012511   Transcript: ENSMICT00000012510
Sequence length 458
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1306:799:4656:-1 gene:ENSMICG00000012511 transcript:ENSMICT00000012510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFSNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHRRWLKALP
RVTPFYAVKCNDSRAIVKTLATIGTGFDCASKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVQMMFDSEVEMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLLLE
RAKELNIDVIGVSFHVGSGCTDPETFVQAISDARYVFDMGAEVGFSMYLLDIGGGFPGSE
DVKLKFEEITSVVNPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQIG
SDDEDESNEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXACASASINV
Download sequence
Identical sequences ENSMICP00000011393 ENSMICP00000011393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]