SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011433 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011433
Domain Number 1 Region: 128-255
Classification Level Classification E-value
Superfamily TPR-like 8.35e-24
Family Tetratricopeptide repeat (TPR) 0.0013
Further Details:      
 
Domain Number 2 Region: 3-125
Classification Level Classification E-value
Superfamily FKBP-like 4.12e-21
Family FKBP immunophilin/proline isomerase 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011433   Gene: ENSMICG00000012557   Transcript: ENSMICT00000012552
Sequence length 315
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_963:300:4566:-1 gene:ENSMICG00000012557 transcript:ENSMICT00000012552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGLLRKKTLVPGPPGSSRPGQGQVVTVQLQTSLENGTRVQEEPELVFTLGDCDVIQALDL
SVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDGPDLETLSGQER
VALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMSLEEEEQLLQLKVKCLNN
LAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEP
SNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAV
ALGGVALSVVIAARN
Download sequence
Identical sequences ENSMICP00000011433 ENSMICP00000011433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]